2.50 Rating by CuteStat

trustme.business is 3 years 9 months old. It is a domain having business extension. It has a global traffic rank of #6524240 in the world. This website is estimated worth of $ 240.00 and have a daily income of around $ 1.00. As no active threats were reported recently by users, trustme.business is SAFE to browse.

PageSpeed Score
0
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: 129
Daily Pageviews: 258

Estimated Valuation

Income Per Day: $ 1.00
Estimated Worth: $ 240.00

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 6,524,240
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

165.227.9.95

Hosted Country:

United States of America US

Location Latitude:

37.3417

Location Longitude:

-121.9753
trustme.business — Coming Soon

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 1 H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: Not Applicable
Google Adsense: Not Applicable Google Analytics: Not Applicable

HTTP Header Analysis

HTTP/1.1 200 OK
Server: nginx
Date: Wed, 05 Aug 2020 18:18:40 GMT
Content-Type: text/html
Last-Modified: Tue, 04 Aug 2020 14:18:22 GMT
Transfer-Encoding: chunked
Connection: keep-alive
Keep-Alive: timeout=60
ETag: W/"5f296e2e-41f"
Content-Encoding: gzip

Domain Information

Domain Registrar: NAMECHEAP INC
Registration Date: Aug 4, 2020, 9:56 AM 3 years 9 months 1 week ago
Expiration Date: Aug 4, 2021, 9:56 AM 2 years 9 months 1 week ago
Domain Status:
clienttransferprohibited
addperiod

Domain Nameserver Information

Host IP Address Country
dns1.registrar-servers.com 156.154.132.200 United States of America United States of America
dns2.registrar-servers.com 156.154.133.200 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
trustme.business A 1799 IP: 165.227.9.95
trustme.business NS 1800 Target: dns1.registrar-servers.com
trustme.business NS 1800 Target: dns2.registrar-servers.com
trustme.business SOA 3601 MNAME: dns1.registrar-servers.com
RNAME: hostmaster.registrar-servers.com
Serial: 1596550572
Refresh: 43200
Retry: 3600
Expire: 604800
Minimum TTL: 3601
trustme.business MX 1800 Priority: 20
Target: eforward5.registrar-servers.com
trustme.business MX 1800 Priority: 15
Target: eforward4.registrar-servers.com
trustme.business MX 1800 Priority: 10
Target: eforward1.registrar-servers.com
trustme.business MX 1800 Priority: 10
Target: eforward2.registrar-servers.com
trustme.business MX 1800 Priority: 10
Target: eforward3.registrar-servers.com
trustme.business TXT 1800 TXT: v=spf1
include:spf.efwd.registrar-servers.com
~all

Similarly Ranked Websites

Fat Diminisher System eBook Review By Wesley Virgin

- fatdiminishersystemreviewpdf.com

Today i am going to show you Fat Diminisher System eBook Review By Wesly Virgin in a detail. What actually the program is all about and does it really work?

6,524,247 $ 8.95

Welcome - Mathematical Association of NSW Inc.

- mansw.nsw.edu.au
6,524,256 $ 240.00

Welcome To Ismail Nasir Shipping L.L.C

- ismailnasirshipping.com
6,524,262 $ 240.00

Taberita.com

- taberita.com

Berita unik, politik, ekonomi, wisata, budaya, hukum dan pendidikan dari Madura. Meliputi Bangkalan, Sampang, Pamekasan, Sumenep.

6,524,263 $ 240.00

EURODOZER - продажа техники

- eurodozer.ru

Евродозер предлагает самый широкий спектр строительной, дорожной, подъемной, лесной, специальной и техники из Европы. Самые выгодные предложения!

6,524,299 $ 240.00

Full WHOIS Lookup

Domain name: trustme.business
Registry Domain ID: 6eed8cb311a24e93abdee031a4cf410b-DONUTS
Registrar WHOIS Server: whois.namecheap.com
Registrar URL: http://www.namecheap.com
Updated Date: 0001-01-01T00:00:00.00Z
Creation Date: 2020-08-04T04:11:18.17Z
Registrar Registration Expiration Date: 2021-08-04T04:11:18.17Z
Registrar: NAMECHEAP INC
Registrar IANA ID: 1068
Registrar Abuse Contact Email: abuse@namecheap.com
Registrar Abuse Contact Phone: +1.6613102107
Reseller: NAMECHEAP INC
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: addPeriod https://icann.org/epp#addPeriod
Registry Registrant ID:
Registrant Name: WhoisGuard Protected
Registrant Organization: WhoisGuard, Inc.
Registrant Street: P.O. Box 0823-03411
Registrant City: Panama
Registrant State/Province: Panama
Registrant Postal Code:
Registrant Country: PA
Registrant Phone: +507.8365503
Registrant Phone Ext:
Registrant Fax: +51.17057182
Registrant Fax Ext:
Registrant Email: bad963f9d46e425dae1b1eaab5f8549e.protect@whoisguard.com
Registry Admin ID:
Admin Name: WhoisGuard Protected
Admin Organization: WhoisGuard, Inc.
Admin Street: P.O. Box 0823-03411
Admin City: Panama
Admin State/Province: Panama
Admin Postal Code:
Admin Country: PA
Admin Phone: +507.8365503
Admin Phone Ext:
Admin Fax: +51.17057182
Admin Fax Ext:
Admin Email: bad963f9d46e425dae1b1eaab5f8549e.protect@whoisguard.com
Registry Tech ID:
Tech Name: WhoisGuard Protected
Tech Organization: WhoisGuard, Inc.
Tech Street: P.O. Box 0823-03411
Tech City: Panama
Tech State/Province: Panama
Tech Postal Code:
Tech Country: PA
Tech Phone: +507.8365503
Tech Phone Ext:
Tech Fax: +51.17057182
Tech Fax Ext:
Tech Email: bad963f9d46e425dae1b1eaab5f8549e.protect@whoisguard.com
Name Server: dns1.registrar-servers.com
Name Server: dns2.registrar-servers.com
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2020-08-05T14:18:49.14Z <<<
For more information on Whois status codes, please visit https://icann.org/epp